MoglabsIGF-1 DES
IGF-1 DES 1mg
1 mg· 1 mg· Fine White Lyophilized Powder purity· vial
Research-grade IGF-1 DES (1-3) lyophilized powder for laboratory use.
Tap I use this — we'll set up your dose, reminders & journey in 30 seconds.
Vendor price
USD 28.00
unknown
About this product
These products are intended for laboratory research purposes only, and are not for human or animal consumption. The products are not intended to [redacted], [redacted], [redacted], or [redacted] any disease. The products should not be used as a food, drug, cosmetic, or other household use. Physical Appearance: Fine White Lyophilized Powder. Pubchem LCSS available for laboratory safety. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGS SSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA.
Specifications
- Peptide
- IGF-1 DES
- Strength
- 1 mg
- Package
- 1 mg
- Purity
- Fine White Lyophilized Powder
- Form
- vial
More from Moglabs
Other products in catalog
Research-use only. Not for human or veterinary use. MyDosage does not sell or ship this product — purchases happen directly with Moglabs.